PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0894s0120.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 251aa    MW: 28558.9 Da    PI: 10.0472
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0894s0120.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM76.94.7e-2427059128
                     NAM  59 yfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             y F++r++ky++g+r++ra++ gyWkatgkdk+v+  +g+lvg +ktL fy+g+a +gekt+W mhe+++
  SapurV1A.0894s0120.1.p   2 YLFTPRNRKYRNGSRPSRAADGGYWKATGKDKPVKY-RGTLVGYRKTLDFYTGKALQGEKTNWKMHEFTV 70 
                             99**********************************.999****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100534.288199IPR003441NAC domain
PfamPF023651.3E-10269IPR003441NAC domain
SuperFamilySSF1019414.97E-31299IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MYLFTPRNRK YRNGSRPSRA ADGGYWKATG KDKPVKYRGT LVGYRKTLDF YTGKALQGEK  60
TNWKMHEFTV NVPDPNHQVR NTRDYMRLDD WVLCKIYKKI KKPNDVRNRQ RDEESSALTA  120
IDDVNSVDHH GEDRTDLPVM DSGHAGEIDM LVPVLFLPMT IANKRSLQVN SLLILTSLLL  180
HIAACFPVWP RLVEILPKYF ANSDNLSAQD ELLNPIVLLL ATKSCNQPVN FSSRCAKKQP  240
ALMNRSGLRV *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-2829972168Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002304383.23e-87hypothetical protein POPTR_0003s10250g
TrEMBLB9GZX04e-87B9GZX0_POPTR; Uncharacterized protein
STRINGPOPTR_0003s10250.11e-86(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2827733
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01720.14e-32NAC family protein